GLOW
£64.99
Product Name: GLOW (BPC157 10mg+GHKCU 50mg+TB500 10mg )
Form: Lyophilized Powder
Storage & Handling:
– Storage (Lyophilized): Store at -20°C in a dry, desiccated environment.
– After Reconstitution: Store reconstituted peptide at 2–8°C and use within 30 days. For long-term storage, aliquot and freeze at -20°C. Avoid repeated freeze-thaw cycles.
– Reconstitution: Reconstitute in sterile bacteriostatic water or appropriate buffer depending on experimental needs.
GHK-Cu + BPC-157 + TB-500)
1) GHK-Cu (Copper Tripeptide-1)
• CAS: 89030-95-5
• Molecular Formula: C₁₄H₂₂CuN₆O₄
(GHK chelated to Cu²⁺ with loss of two protons)
• Molecular Weight: ≈401.9 g/mol
• Purity: ≥99%
• Peptide Sequence:
Gly-His-Lys.Cu.xHAc
2) BPC-157
• CAS: 137525-51-0
• Molecular Formula: C₆₂H₉₈N₁₆O₂₂
• Molecular Weight: ~1419.5 g/mol
• Purity: ≥99%
• Peptide Sequence:
GEPPPGKPADDAGLV
3) TB-500 (Thymosin β-4, full length)
• CAS: 77591-33-4
• Molecular Formula: C₂₁₂H₃₅₀N₅₆O₇₈S
• Molecular Weight: ~4963.4 g/mol
• Purity: ≥99%
• Peptide Sequence (43 aa):
SDKPDMAEIEKFDKSKLKESQAGETSDDEDVVVTDT
This product is sold strictly for in vitro research and laboratory use only. By purchasing or using this product, the buyer agrees they have read, understood and accept the legal policy of MachQlabs.


