Tesamorelin
£29.99 – £89.99Price range: £29.99 through £89.99
Product Name: Tesamorelin
Form: Lyophilized Powder
Storage & Handling:
– Storage (Lyophilized): Store at -20°C in a dry, desiccated environment.
– After Reconstitution: Store reconstituted peptide at 2–8°C and use within 30 days. For long-term storage, aliquot and freeze at -20°C. Avoid repeated freeze-thaw cycles.
– Reconstitution: Reconstitute in sterile bacteriostatic water or appropriate buffer depending on experimental needs.
• CAS: 901758-09-6
• Molecular Formula: C₂₂₃H₃₇₀N₇₂O₆₉S
• Molecular Weight: ~5135.9 g/mol
• Purity: ≥99%
• Peptide Sequence:
YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
This product is sold strictly for in vitro research and laboratory use only. By purchasing or using this product, the buyer agrees they have read, understood and accept the legal policy of MachQlabs.


